General Information

  • ID:  hor002770
  • Uniprot ID:  D2DIJ7
  • Protein name:  AKH/corazonin-related peptide
  • Gene name:  100313509
  • Organism:  Nasonia vitripennis (Parasitic wasp)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nasonia (genus), Pteromalinae (subfamily), Pteromalidae (family), Chalcidoidea (superfamily), Parasitoida (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVTFSKGWGP
  • Length:  10(26-35)
  • Propeptide:  MGRRLSIGLAAAAILFSCMLHFALAQVTFSKGWGPGKRSALYETDCSRVNYKSLALLFHTLLAEVKHLMACDHQATVNYLQSVERQ
  • Signal peptide:  MGRRLSIGLAAAAILFSCMLHFALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-D2DIJ7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002770_AF2.pdbhor002770_ESM.pdb

Physical Information

Mass: 126695 Formula: C52H75N13O14
Absent amino acids: ACDEHILMNRY Common amino acids: G
pI: 9.7 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -52 Boman Index: -583
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 29
Instability Index: -121 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  20695486
  • Title:  Genomics and Peptidomics of Neuropeptides and Protein Hormones Present in the Parasitic Wasp Nasonia Vitripennis